◈ Boise Standard · Unverified Record
Unclaimed Entity · Boise Standard · Treasure Valley, Idaho
cafetariacharlyarnhemseweg-apeldoorn.nl
Cafetaria Charly Arnhemseweg - Eten bestellen in Apeldoorn
FEDERATION ID: —
STATUS: UNCLAIMED
◈ Verification Package · What You Receive
Six deliverables. Stated plainly.
◈
Verified JSON-LD Schema Package
Your complete schema.org markup built from your intake responses. Every identified gap addressed. Ready to deploy into your website
<head>. This is what AI crawlers read when they evaluate your entity.◈
Boise Standard Verification Certificate
Federation ID
gdr-xxxxxxxx · domain · mint date · verified date · schema coverage score · pipeline version. Your entity's declared membership in the Boise Standard registry — America's first AI directory, built here for here.◈
Entity Graph Edge Declarations
Your entity connected to its geographic region, city, county, industry category, niche, and related concepts. Each declared relationship is a traversable path in the Treasure Valley knowledge graph.
◈
The AI Era Intelligence Brief
An exclusive guide covering how AI retrieval works, why the shift from keywords to entities happened, and what it means for your digital presence. Schema.org, knowledge graphs, structured data — the kind of document a $5,000/month agency would charge to produce.
◈
10 Master Prompts
Ten prompts built for business operators. Plug into Claude, ChatGPT, Gemini, or Perplexity. Cover schema expansion, service description generation, FAQ structured data, geographic edge building, and more — each anchored to your verified Boise Standard record.
◈
Verified Profile at Boise Standard
Your record at
boisestandard.org/web/cafetariacharlyarnhemseweg-apeldoorn-nl updates from unverified to verified. The Atomic Answer is regenerated from your verified data. The record remains live and machine-readable indefinitely. AI systems read it on every retrieval.◈ Verify cafetariacharlyarnhemseweg-apeldoorn.nl · One-Time Payment · Lifetime Record
$25
cafetariacharlyarnhemseweg-apeldoorn.nl
· Federation ID —
◈ Verify This Entity →
🔒
Payment authorized and secured by Stripe
· PCI DSS Level 1 Certified · 256-bit SSL Encryption ·
All major cards accepted · No card data touches our servers
Payment
Stripe
PCI Compliant
PCI Compliant
Delivery
Prompt
Verified · Delivered
Verified · Delivered
Record
Lifetime
Machine-Readable
Machine-Readable
Support
◈ Boise Standard · Registry Record
Record Status
Minted · Unclaimed
Federation ID
—
Schema Coverage
—
Unmapped Properties
—
Pipeline
refinery-boise-v1.0.0
◈ Terms of Verification · Boise Standard
This is a one-time payment of $25. No subscription. No renewal. No cancellation required. Upon payment and completion of the intake form, Boise Standard will update your verified entity profile at boisestandard.org/web/cafetariacharlyarnhemseweg-apeldoorn-nl. By submitting payment and the intake form, you grant Boise Standard a perpetual license to maintain, display, and include your verified record in the registry. Your record will remain live and machine-readable indefinitely. Questions: [email protected]